This is a working overview of residual moisture, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-05-21 and is reviewed periodically as new material appears.
Lyophilization removes water from a frozen material by sublimation under reduced pressure. The process begins with freezing, which converts liquid water into ice and fixes the structure of the sample. After freezing, primary drying lowers pressure so ice changes directly to vapor without passing through a liquid phase. Secondary drying then removes bound water that remains after ice sublimation. The result is a dry, porous solid that often retains its original shape.
The low pressure used during drying allows water vapor to move from the ice surface to a cold condenser. Energy supplied as heat drives sublimation but must stay below the collapse temperature of the frozen matrix. If the product becomes too warm, the frozen structure may soften or melt, reducing pore formation and slowing drying. Formulations often include bulking agents, stabilizers, or buffers to support a rigid cake. The final moisture content depends on formulation, freezing rate, and the length of secondary drying.
Storage conditions depend on the formulation and the intended shelf life. Many pharmaceutical and biological freeze-dried products are kept at 2–8 °C, while some stable foods and reagents tolerate room temperature. Others require −20 °C or colder to slow chemical degradation or aggregation. Protection from light and oxygen is common because oxidation can continue in the dry state. Stability studies usually monitor potency, appearance, moisture, and reconstitution time over months or years. Predictions from accelerated studies are useful but may not fully capture real-time changes.
Quality control for freeze-dried lots combines visual inspection with instrumental tests. Cake appearance, color, and shrinkage are recorded against a reference, while residual moisture is measured by Karl Fischer titration or loss on drying. Thermal analysis can reveal phase transitions and crystallization events, and X-ray diffraction distinguishes amorphous from crystalline solids. Microbiological tests and container closure integrity checks are also routine for sterile products. Analytical methods must be validated for the matrix, because excipients and low moisture can affect accuracy. Open questions include how best to predict long-term stability from short-term data.
| Property | Value | Notes |
|---|---|---|
| Primary phase change | Sublimation | Ice changes directly to vapor under reduced pressure |
| Typical chamber pressure | 0.01–0.5 mbar (1–50 Pa) | Below the triple point of water; product-specific |
| Typical product temperature during primary drying | −40 °C to −10 °C | Kept below collapse temperature |
| Typical residual moisture | 0.5–3% w/w | Target range varies by formulation and use |
| Common synonyms | Freeze-drying; lyophilisation | Lyophilization is the US spelling |
Freeze-drying is used for materials whose activity or structure depends on low temperature and low water content. Examples include certain biologics, diagnostic reagents, starter cultures, coffee, and porous inorganic precursors. The dried product forms a cake whose porosity aids rapid wetting and dissolution. Main drawbacks are high energy use, long cycle times, and sensitivity to formulation and equipment variation. Questions remain about how freezing rates and ice morphology affect batch uniformity, especially when moving from laboratory to production scale.
Lyophilization, also called freeze-drying, is a dehydration process in which a solvent, usually water, is frozen and then removed by sublimation under reduced pressure. The method preserves heat-sensitive materials that would degrade in conventional drying. Large-scale use grew during the mid-twentieth century for blood plasma and antibiotics, and it later expanded to vaccines, enzymes, foods, and advanced materials. The process produces a dry, porous solid that usually reconstitutes rapidly. It is distinct from simple evaporation because the solvent bypasses the liquid phase during primary removal.
The process generally proceeds in three stages: freezing, primary drying, and secondary drying. During freezing, controlled cooling converts water into ice and may also crystallize or vitrify solutes. In primary drying, the pressure is lowered below the triple point, and heat is supplied so ice sublimes directly to vapor. Secondary drying removes water that remains bound to the solid matrix, yielding a low final water content. Product temperature must stay below the collapse or glass transition temperature to maintain structure. Cycle design therefore balances shelf temperature, chamber pressure, and time.
Quality control for lyophilized products includes appearance, cake structure, reconstitution time, pH, residual moisture, and potency. Residual moisture is a key attribute because excess water can reduce stability, while excessively low moisture may cause structural changes or aggregation in some systems. Stability studies compare real-time and accelerated conditions to estimate shelf life. Analytical methods must be validated for the specific matrix, container, and moisture range. Sterility and container integrity are also monitored for sterile products.
Handling practices aim to prevent moisture ingress and mechanical damage. Vials should remain stoppered and crimped until use, and reconstitution should follow the labeled diluent and volume. Shipping may involve temperature-controlled containers and desiccants, but direct contact between desiccant and product is avoided. Regulatory guidance expects documented storage conditions, excursion assessments, and stability commitments. Open questions remain about how best to predict long-term stability from short accelerated studies for every formulation class.
Peptide aptamers consist of one or more peptide loops of variable sequence displayed by a protein scaffold. Derivatives known as tadpoles, in which peptide aptamer "heads" are covalently linked to unique sequence double-stranded DNA "tails", allow quantification of scarce target molecules in mixtures by PCR (using, for example, the quantitative real-time polymerase chain reaction) of their DNA tails. The peptides that form the aptamer variable regions are synthesized as part of the same polypeptide chain as the scaffold and are constrained at their N and C termini by linkage to it. This double structural constraint decreases the diversity of the 3D structures that the variable regions can adopt, and this reduction in structural diversity lowers the entropic cost of molecular binding when interaction with the target causes the variable regions to adopt a uniform structure.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
At 3%, calcium is the fifth most abundant element in the Earth's crust, and the third most abundant metal behind aluminium and iron. It is also the fourth most abundant element in the lunar highlands. Sedimentary calcium carbonate deposits pervade the Earth's surface as fossilised remains of past marine life; they occur in two forms, the rhombohedral calcite (more common) and the orthorhombic aragonite (forming in more temperate seas). Minerals of the first type include limestone, dolomite, marble, chalk, and Iceland spar; aragonite beds make up the Bahamas, the Florida Keys, and the Red Sea basins. Corals, sea shells, and pearls are mostly made up of calcium carbonate. Among the other important minerals of calcium are gypsum (CaSO4·2H2O), anhydrite (CaSO4), fluorite (CaF2), and apatite ([Ca5(PO4)3X], X = OH, Cl, or F) The major producers of calcium are China (about 10000 to 12000 tonnes per year), Russia (about 6000 to 8000 tonnes per year), and the United States (about 2000 to 4000 tonnes per year). Canada and France are among the minor producers. In 2005, about 24000 tonnes of calcium were produced; about half of the world's extracted calcium is used by the United States, with about 80% of the output used each year. In Russia and China, Davy's method of electrolysis is still used, but is instead applied to molten calcium chloride. Since calcium is less reactive than strontium or barium, the oxide–nitride coating that results in air is stable and lathe machining and other standard metallurgical techniques are suitable for calcium. In the U.S.
== Neurodegeneration == Inhibition of Hsp90 leads to Hsp70 and Hsp40 upregulation, which can channel misfolded protein for proteasome degradation, which can potentially inhibit the progression of neurodegenerative diseases. For example, Hsp70 overexpression in human neuroglioma cells transfected with mutant alpha-synuclein led to 50% less oligomeric alpha-synuclein species, pointing towards the possibility that increasing its expression could diminish the spread of Parkinson's disease. Similarly, Hsp70 overexpression suppressed poly-Q dependent aggregation and neurodegeneration in cell cultures, yeast, fly, and mouse models, and deletion of hsp70 increased the size of polyQ inclusion bodies, suggesting that increasing its expression could help to prevent Huntington's disease. Similarly, reductions in Hsp70 have been shown in transgenic mouse models of ALS and patients with sporadic ALS. Lastly, increased expression or activity of Hsp70 has been proposed as a method to prevent the progression of Alzheimer's disease, because knock down of Hsp70 promoted A-beta toxicity, and Hsp70 was shown to promote tau stability, while Hsp70 levels are decreased in tauopathies like Alzheimer's disease. Given the complex interplay between the different chaperone proteins, therapeutic development in this field is aimed at investigating how the chaperone network as a whole can be manipulated and the effect of this manipulation on the progression of neurodegenerative disease, but the balance of Hsp70 and Hsp90 levels appears to be central in this pathophysiology.
Sources: en.wikipedia.org
=== Chronic pain === Chronic pain continues to be regarded as the core characteristic of fibromyalgia. According to the NHS, widespread pain is a major symptom, which could feel like an ache, a burning sensation, or a sharp, stabbing pain. Patients are also susceptible to pain, and the slightest touch can cause pain. Pain also tends to linger for a longer period when a patient experiences it. The pain associated with fibromyalgia is often a constant dull ache that has lasted for at least three months, occurring on both sides of the body and above and below the waist. Pain in fibromyalgia may include contributions from central pain, peripheral musculoskeletal pain generators, neuropathic pain, and other pathways. Men may be affected by FM pain differently to women.
=== Order === The largest increases in strength happen for the exercises in the beginning of a session. Supersets are defined as a pair of different exercise sets performed without rest, followed by a normal rest period. Common superset configurations are two exercises for the same muscle group, agonist-antagonist muscles, or alternating upper and lower body muscle groups. Exercises for the same muscle group (flat bench press followed by the incline bench press) result in a significantly lower training volume than a traditional exercise format with rests. However, agonist–antagonist supersets result in a significantly higher training volume when compared to a traditional exercise format. Similarly, holding training volume constant but performing upper–lower body supersets and tri-sets reduce elapsed time but increased perceived exertion rate. These results suggest that specific exercise orders may allow more intense, more time-efficient workouts with results similar to longer workouts.
The two substrates of this enzyme are D-fructose (shown in its keto form) and oxidised nicotinamide adenine dinucleotide phosphate (NADP+). ts products are 5-dehydro-D-fructose, reduced NADPH, and a proton. This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. The systematic name of this enzyme class is D-fructose:NADP+ 5-oxidoreductase. Other names in common use include 5-ketofructose reductase (NADP+), 5-keto-D-fructose reductase (NADP+), fructose 5-(nicotinamide adenine dinucleotide phosphate), dehydrogenase, D-(-)fructose:(NADP+) 5-oxidoreductase, and fructose 5-dehydrogenase (NADP+).
Similar patterns in other Xanthoria species suggest that, despite limited variation within local populations, long-distance dispersal and genetic drift contribute to regional differentiation and ecological adaptation. At broader spatial scales, X. parietina populations show a pattern of isolation by distance—genetic differences increase with geographic separation. A global genetic study using RAPD-PCR fingerprinting identified just two major genetic clusters worldwide: one in southwestern Europe (Iberian Peninsula, Balearic and Canary Islands) and another spanning Europe, North America, Australia, and New Zealand. The high similarity between Australian/New Zealand samples and those from Europe indicates the species was introduced by humans to the Southern Hemisphere, possibly via grapevine transport or ship ballast stones. A similar human introduction has been suggested for the lichen in the populated Willamette Valley of the western United States, and in Ontario, where it may have arrived on nursery trees. The high genetic diversity observed in X. parietina has several practical implications for its ecology and conservation. This diversity likely supports the species' adaptability to different environments—from coastal rocks to urban trees and polluted areas. High genetic variation within local populations provides material for natural selection, enabling adaptation to changing conditions including pollution levels and climate shifts. The different genetic structures between the fungal and algal partners suggest that X.
The first cornea transplant was performed in 1905 by Eduard Zirm (Olomouc Eye Clinic, now Czech Republic), making it one of the first types of transplant surgery successfully performed. Another pioneer of the operation was Ramón Castroviejo. Russian eye surgeon Vladimir Filatov's attempts at transplanting cornea started with the first try in 1912 and were continued, gradually improving until on 6 May 1931 he successfully grafted a patient using corneal tissue from a deceased person. He widely reported another transplant in 1936, disclosing his technique in full detail. In 1936, Castroviejo did a first transplantation in an advanced case of keratoconus, achieving significant improvement in patient's vision. Tudor Thomas, a clinical teacher for the Welsh National School of Medicine, conceived the idea of a donor system for corneal grafts and an eye bank was established in East Grinstead in 1955. Advances in operating microscopes enabled surgeons to have a more magnified view of the surgical field, while advances in materials science enabled them to use sutures finer than a human hair. Instrumental in the success of cornea transplants were the establishment of eye banks. These are organizations located throughout the world to coordinate the distribution of donated corneas to surgeons, as well as providing eyes for research. Some eye banks also distribute other anatomical gifts.
Sources: en.wikipedia.org
== Characteristics == Other than nuclear properties, no properties of oganesson or its compounds have been measured; this is due to its extremely limited and expensive production and the fact that it decays very quickly. Thus only predictions are available.
=== Synthetic genomics === The formation of animals with a chemically manufactured (minimal) genome is another facet of synthetic biology that is highlighted by synthetic genomics. This area of synthetic biology has been made possible by ongoing advancements in DNA synthesis technology, which now makes it feasible to produce DNA molecules with thousands of base pairs at a reasonable cost. The goal is to combine these molecules into complete genomes and transplant them into living cells, replacing the host cell's genome and reprogramming its metabolism to perform different functions. Scientists have previously demonstrated the potential of this approach by creating infectious viruses by synthesising the genomes of multiple viruses. These significant advances in science and technology triggered the initial public concerns concerning the risks associated with this technology. A simple genome might also work as a "chassis genome" that could be enlarged quickly by gene inclusion created for particular tasks. Such "chassis creatures" would be more suited for the insertion of new functions than wild organisms since they would have fewer biological pathways that could potentially conflict with the new functionalities in addition to having specific insertion sites. Synthetic genomics strives to create creatures with novel "architectures," much like the bioengineering method. It adopts an integrative or holistic perspective of the organism.
Vernon Bogdanor (born 16 July 1943); author, academic, scholar, political scientist, historian, and research professor at the Institute for Contemporary British History at King's College London; emeritus professor of politics and government at the University of Oxford and an emeritus fellow of Brasenose College, Oxford; appointed Commander of the Order of the British Empire (CBE) in the 1998 Birthday Honours for services to constitutional history; appointed a Chevalier de la Légion d'honneur by president of France, Nicolas Sarkozy; was knighted in 2023 New Year Honours for services to political science. David Bohm (20 December 1917 – 27 October 1992) American British scientist and prolific author described as one of the most significant theoretical physicists of the 20th century, who contributed unorthodox ideas to quantum theory, neuropsychology and the philosophy of mind, of Hungarian Jewish origin. Alain de Botton popular author, broadcaster and YouTube channel entrepreneur, of Ashkenazi and Sephardic ancestry. He co-founded The School of Life. Botton is the son of Gilbert de Botton and descended from a distinguished Sephardic Jewish family; among his ancestors were the rabbinical scholar Abraham de Boton and Yolande Harmer journalist and Israeli intelligence officer.
=== Melanoma === Tumour-associated macrophages can be attracted by cytokines such as TGF-β and IL-10 produced by tumours in melanoma. These cytokines can also trigger the M2 polarisation of the infiltrated tumour-associated macrophages. Infiltrated macrophages that acquire the M2 phenotype are anti-inflammatory. They facilitate tumour growth and proliferation via immunosuppression, further cytokine production, and tumour angiogenesis. Tumour-associated macrophages also promote the invasion of cancer cells via the production of miRNA exosomes.
Sources: en.wikipedia.org
Lyophilization relies on sublimation, so water moves from solid ice to vapor without becoming liquid. The material is frozen, pressure is reduced, and controlled heat is supplied. Vapor is captured on a cold condenser, leaving a dry porous solid.
The process has three main stages: freezing, primary drying, and secondary drying. Freezing sets the ice structure, primary drying removes free ice, and secondary drying removes bound water. Each stage uses specific temperature, pressure, and time settings.
No, it is a drying method rather than a sterilization method. Removing water can limit microbial growth, but it does not reliably kill microorganisms. Sterility must come from separate steps such as filtration, heat treatment, or aseptic processing.
Karl Fischer titration is widely used because it is specific for water and works at low levels. Loss on drying is simpler but less specific, since volatile solvents or decomposition products can also be lost.